PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 318aa    MW: 35033.7 Da    PI: 10.067
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608880.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA88.41e-27150204258
       CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      p++VNaKQy++Il+RR++Rak  e kk   k rkpylh SRh hA+rRpRg+gGrF
  XP_009608880.1 150 GPIFVNAKQYHGILRRRKSRAKEME-KKA-LKPRKPYLHLSRHLHAMRRPRGCGGRF 204
                     69*******************9666.555.6*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-30147207IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.964148207IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-23151204IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.3E-21151173IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.3E-21181204IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MTIMHTLFSS KGNEGIVQNP VATLSTTVPW WSSGLVSQSS SAEHSELPKG NATEFTIFSG  60
DWKSSGYGQN QSNIQAVANM DYRGQFELGF GQSLISAKYP YGGEQSVGLF SAYGPQLSRN  120
VQNSTVNGAQ TLYVNMGRVM LPLNLASDEG PIFVNAKQYH GILRRRKSRA KEMEKKALKP  180
RKPYLHLSRH LHAMRRPRGC GGRFLNTRKM NGTMKGGKTT DTVKTGDVYS FYPIGSQNSE  240
VLQSDSSNLS SPKETTGSRL CHSSEVTNMY CRRNLDPFPF QDLRPSVQPI PDMMNTGHGI  300
LMAGKWVSAA DSCCNLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A2e-16149205260HAPB protein
4g91_A2e-16149205260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4897581e-171AM489758.1 Petunia x hybrida partial mRNA for YA1 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608880.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLM1BXA51e-162M1BXA5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000550611e-161(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.18e-38nuclear factor Y, subunit A2